Web Analytics
settings Currency keyboard_arrow_down
USDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
menu
phoneemailinfo@nik-nak-nook.com
shopping_cart Basket (0)
Special Offers
location_on
5,000 mAh Power Bank (Desert Marble) by love, ellis
5,000 mAh Power Bank (Desert Marble) by love, ellis 5,000 mAh Power Bank (Desert Marble) by love, ellis

5,000 mAh Power Bank (Desert Marble) by love, ellis

Product Code:  LEPB-0048
Product Description
The Desert Marble Love, Ellie 5,000 mAh Power Bank keeps your tech charged in style while out and about. This power bank is slim and lightweight with a soft matte finish. It offers up to 24 hours of extra battery life and is rechargeable via the included micro USB cable.

DETAILS

  • 5,000 mAh power bank
  • Up to 24 hours of extra battery life
  • USB-A output
  • Micro USB input
  • Designed in Los Angeles
  • Includes micro USB to USB-A cable
  • Desert Marble
  • UPC 840234400876
  •  1-year
     3.7000 VOLT
     3.7000 VOLT
     Li-ion Battery
     White
     1.0000 INCH
     Retail
     6.0000 INCH
     Desert Marble
     3.5400 INCH
     0.5100 INCH
     0.2600 POUND
     2.4000 INCH
     White
     0.3000 POUND
     4.5000 INCH
     Product is a Battery
     1
     Other/Product Specific
     1
     Lithium Ion
     Not Applicable

    ⊗Due to the existence of lithium batteries, additional shipping charges or restrictions may apply. Shipping restrictions may require a ship method that is limited to GROUND and this may impact time in transit and available delivery locations.
RRP $44.99
$38.24 inc. tax
$38.24 ex. tax
? Tax based on Michigan, United States.
Add to Cart Quantity
Product Details
Brand: AlchoHawk
weight: 16.0oz
Product Condition: New
Updating Order Details
Please do not refresh or navigate away from the page!
Product Description
No Reviews Posted Yet - be the first! write review
Featured Products
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i